IGF 1 LR3 1mg

IGF LR3 (Long Arginine 3-IGF-1) 1mg – Premium Research Peptide

Long Arginine 3-IGF-1 (IGF-1 LR3), available in a 1mg quantity, is a premium-grade research peptide designed for advanced biochemical and scientific investigations. This product is perfectly suited for laboratory environments where accuracy and consistency are essential.

Product Details:

Name: IGF LR3 1mg

Catalogue Number: GP-IGF1LR3-1

Molecular Weight: 9117.60 g/mol

Purity: ≥98%

Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Form: Lyophilised powder

Usage and Storage Instructions:

IGF-1 LR3 is supplied as a lyophilised powder to maintain optimal stability and facilitate ease of use in research settings. For optimal results, please refer to our website for comprehensive instructions on reconstitution and storage.

Synthesis and Quality Control:

This peptide is carefully synthesized under controlled conditions to ensure a high purity level of at least 98%, guaranteeing stability and suitability for precise scientific applications. Each batch undergoes rigorous quality control to meet the high standards demanded by researchers.

Legal and Safety Notice:

The Peptide Store offers Long Arginine 3-IGF-1 (IGF-1 LR3) exclusively for scientific research purposes. We are committed to supporting the research community by providing products that comply with strict quality and legal standards. Please be aware that this peptide is not intended for human consumption or clinical use.